| Brand: | Abnova |
| Reference: | H00003170-M04A |
| Product name: | FOXA2 monoclonal antibody (M04A), clone 7G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXA2. |
| Clone: | 7G10 |
| Isotype: | IgM Kappa |
| Gene id: | 3170 |
| Gene name: | FOXA2 |
| Gene alias: | HNF3B|MGC19807|TCF3B |
| Gene description: | forkhead box A2 |
| Genbank accession: | NM_021784 |
| Immunogen: | FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
| Protein accession: | NP_068556 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FOXA2 monoclonal antibody (M04A), clone 7G10 Western Blot analysis of FOXA2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |