Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HMGA1 monoclonal antibody (M03), clone 2A1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about HMGA1 monoclonal antibody (M03), clone 2A1
| Brand: | Abnova |
| Reference: | H00003159-M03 |
| Product name: | HMGA1 monoclonal antibody (M03), clone 2A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HMGA1. |
| Clone: | 2A1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3159 |
| Gene name: | HMGA1 |
| Gene alias: | HMG-R|HMGA1A|HMGIY|MGC12816|MGC4242|MGC4854 |
| Gene description: | high mobility group AT-hook 1 |
| Genbank accession: | NM_145899 |
| Immunogen: | HMGA1 (NP_665906.1, 1 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
| Protein accession: | NP_665906.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HMGA1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M. Chembiochem. 2016 Jan;17(2):181-9. doi: 10.1002/cbic.201500519. Epub 2015 Dec 9. |