View larger

HMGN2 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of HMGN2 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00003151-P01
Product name:	HMGN2 (Human) Recombinant Protein (P01)
Product description:	Human HMGN2 full-length ORF ( AAH14644, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	3151
Gene name:	HMGN2
Gene alias:	HMG17\|MGC5629\|MGC88718
Gene description:	high-mobility group nucleosomal binding domain 2
Genbank accession:	BC014644
Immunogen sequence/protein sequence:	MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Protein accession:	AAH14644
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Serine ADP-Ribosylation Depends on HPF1.Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E Zaja R, Ahel I, Matic I. Mol Cell. 2017 Mar 2;65(5):932-940.e6. doi: 10.1016/j.molcel.2017.01.003. Epub 2017 Feb 9.