Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HMGB1 monoclonal antibody (M01), clone 1E6-E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Tr |
More info about HMGB1 monoclonal antibody (M01), clone 1E6-E10
| Brand: | Abnova |
| Reference: | H00003146-M01 |
| Product name: | HMGB1 monoclonal antibody (M01), clone 1E6-E10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HMGB1. |
| Clone: | 1E6-E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3146 |
| Gene name: | HMGB1 |
| Gene alias: | DKFZp686A04236|HMG1|HMG3|SBP-1 |
| Gene description: | high-mobility group box 1 |
| Genbank accession: | BC003378 |
| Immunogen: | HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Protein accession: | AAH03378.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Emodin-6-O-β-D-glucoside inhibits HMGB1-induced inflammatory responses in vitro and in vivo.Lee W, Ku SK, Kim TH, Bae JS. Food Chem Toxicol. 2012 Nov 9. doi:pii: S0278-6915 (12)00806-X. 10.1016/ j.fct.2012.10.061. [Epub ahead of print] |