No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003126-M01A |
| Product name: | HLA-DRB4 monoclonal antibody (M01A), clone 4C8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant HLA-DRB4. |
| Clone: | 4C8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3126 |
| Gene name: | HLA-DRB4 |
| Gene alias: | DRB4|HLA-DR4B |
| Gene description: | major histocompatibility complex, class II, DR beta 4 |
| Genbank accession: | BC005312 |
| Immunogen: | HLA-DRB4 (AAH05312, 30 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS |
| Protein accession: | AAH05312 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | HLA-DRB4 monoclonal antibody (M01A), clone 4C8. Western Blot analysis of HLA-DRB4 expression in human kidney. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |