Brand: | Abnova |
Reference: | H00003120-M01 |
Product name: | HLA-DQB2 monoclonal antibody (M01), clone 4C3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HLA-DQB2. |
Clone: | 4C3 |
Isotype: | IgG2a Kappa |
Gene id: | 3120 |
Gene name: | HLA-DQB2 |
Gene alias: | HLA-DQB1|HLA-DXB |
Gene description: | major histocompatibility complex, class II, DQ beta 2 |
Genbank accession: | BC031995 |
Immunogen: | HLA-DQB2 (AAH31995, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH |
Protein accession: | AAH31995 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HLA-DQB2 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |