HLA-DQB2 monoclonal antibody (M01), clone 4C3 View larger

HLA-DQB2 monoclonal antibody (M01), clone 4C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HLA-DQB2 monoclonal antibody (M01), clone 4C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about HLA-DQB2 monoclonal antibody (M01), clone 4C3

Brand: Abnova
Reference: H00003120-M01
Product name: HLA-DQB2 monoclonal antibody (M01), clone 4C3
Product description: Mouse monoclonal antibody raised against a full-length recombinant HLA-DQB2.
Clone: 4C3
Isotype: IgG2a Kappa
Gene id: 3120
Gene name: HLA-DQB2
Gene alias: HLA-DQB1|HLA-DXB
Gene description: major histocompatibility complex, class II, DQ beta 2
Genbank accession: BC031995
Immunogen: HLA-DQB2 (AAH31995, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Protein accession: AAH31995
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003120-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.15 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003120-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HLA-DQB2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HLA-DQB2 monoclonal antibody (M01), clone 4C3 now

Add to cart