HLA-DOB MaxPab mouse polyclonal antibody (B01) View larger

HLA-DOB MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HLA-DOB MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about HLA-DOB MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003112-B01
Product name: HLA-DOB MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HLA-DOB protein.
Gene id: 3112
Gene name: HLA-DOB
Gene alias: DOB
Gene description: major histocompatibility complex, class II, DO beta
Genbank accession: NM_002120
Immunogen: HLA-DOB (NP_002111, 1 a.a. ~ 273 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Protein accession: NP_002111
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003112-B01-13-15-1.jpg
Application image note: Western Blot analysis of HLA-DOB expression in transfected 293T cell line (H00003112-T01) by HLA-DOB MaxPab polyclonal antibody.

Lane 1: HLA-DOB transfected lysate(30.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HLA-DOB MaxPab mouse polyclonal antibody (B01) now

Add to cart