| Brand: | Abnova |
| Reference: | H00003109-M01 |
| Product name: | HLA-DMB monoclonal antibody (M01), clone 6B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HLA-DMB. |
| Clone: | 6B3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3109 |
| Gene name: | HLA-DMB |
| Gene alias: | D6S221E|RING7 |
| Gene description: | major histocompatibility complex, class II, DM beta |
| Genbank accession: | NM_002118 |
| Immunogen: | HLA-DMB (NP_002109, 22 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE |
| Protein accession: | NP_002109 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Increased HLA-DMB Expression in the Tumor Epithelium Is Associated with Increased CTL Infiltration and Improved Prognosis in Advanced-Stage Serous Ovarian Cancer.Callahan MJ, Nagymanyoki Z, Bonome T, Johnson ME, Litkouhi B, Sullivan EH, Hirsch MS, Matulonis UA, Liu J, Birrer MJ, Berkowitz RS, Mok SC. Clin Cancer Res. 2008 Dec 1;14(23):7667-73. |