Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003094-M05 |
Product name: | HINT1 monoclonal antibody (M05), clone 2D7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant HINT1. |
Clone: | 2D7 |
Isotype: | IgG2b Kappa |
Gene id: | 3094 |
Gene name: | HINT1 |
Gene alias: | FLJ30414|FLJ32340|HINT|PKCI-1|PRKCNH1 |
Gene description: | histidine triad nucleotide binding protein 1 |
Genbank accession: | BC001287 |
Immunogen: | HINT1 (AAH01287, 1 a.a. ~ 126 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
Protein accession: | AAH01287 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.6 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HINT1 expression in transfected 293T cell line by HINT1 monoclonal antibody (M05), clone 2D7. Lane 1: HINT1 transfected lysate(13.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |