Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003094-A01 |
Product name: | HINT1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HINT1. |
Gene id: | 3094 |
Gene name: | HINT1 |
Gene alias: | FLJ30414|FLJ32340|HINT|PKCI-1|PRKCNH1 |
Gene description: | histidine triad nucleotide binding protein 1 |
Genbank accession: | NM_005340 |
Immunogen: | HINT1 (NP_005331, 59 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | HISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
Protein accession: | NP_005331 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.59 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | HINT1 protein: A new therapeutic target to enhance opioid antinociception and block mechanical allodyniaGarzon J, Herrero-Labrador R, Rodriguez-Munoz M, Shah R, Vicente-Sanchez A, Wagner CR, Sanchez-Blazquez P. Neuropharmacology (2014), doi:10.1016/j.neuropharm. 2014.10.022 |