Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HINT1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HINT1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003094-A01 |
| Product name: | HINT1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HINT1. |
| Gene id: | 3094 |
| Gene name: | HINT1 |
| Gene alias: | FLJ30414|FLJ32340|HINT|PKCI-1|PRKCNH1 |
| Gene description: | histidine triad nucleotide binding protein 1 |
| Genbank accession: | NM_005340 |
| Immunogen: | HINT1 (NP_005331, 59 a.a. ~ 126 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
| Protein accession: | NP_005331 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | HINT1 protein: A new therapeutic target to enhance opioid antinociception and block mechanical allodyniaGarzon J, Herrero-Labrador R, Rodriguez-Munoz M, Shah R, Vicente-Sanchez A, Wagner CR, Sanchez-Blazquez P. Neuropharmacology (2014), doi:10.1016/j.neuropharm. 2014.10.022 |