Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HIF1A monoclonal antibody (M01A), clone 2E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HIF1A monoclonal antibody (M01A), clone 2E11
| Brand: | Abnova |
| Reference: | H00003091-M01A |
| Product name: | HIF1A monoclonal antibody (M01A), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HIF1A. |
| Clone: | 2E11 |
| Isotype: | IgG Mix Kappa |
| Gene id: | 3091 |
| Gene name: | HIF1A |
| Gene alias: | HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78 |
| Gene description: | hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) |
| Genbank accession: | NM_001530 |
| Immunogen: | HIF1A (NP_001521, 717 a.a. ~ 826 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN |
| Protein accession: | NP_001521 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |