| Brand: | Abnova |
| Reference: | H00003090-M04 |
| Product name: | HIC1 monoclonal antibody (M04), clone 2C1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HIC1. |
| Clone: | 2C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3090 |
| Gene name: | HIC1 |
| Gene alias: | ZBTB29|hic-1 |
| Gene description: | hypermethylated in cancer 1 |
| Genbank accession: | NM_006497 |
| Immunogen: | HIC1 (NP_006488.2, 627 a.a. ~ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
| Protein accession: | NP_006488.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |