No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003087-M13 |
Product name: | HHEX monoclonal antibody (M13), clone 2B12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HHEX. |
Clone: | 2B12 |
Isotype: | IgG2a Kappa |
Gene id: | 3087 |
Gene name: | HHEX |
Gene alias: | HEX|HMPH|HOX11L-PEN|PRH|PRHX |
Gene description: | hematopoietically expressed homeobox |
Genbank accession: | NM_002729 |
Immunogen: | HHEX (NP_002720, 133 a.a. ~ 237 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS |
Protein accession: | NP_002720 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M13), clone 2B12. Lane 1: HHEX transfected lysate(30.02 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |