| Brand: | Abnova |
| Reference: | H00003087-M10 |
| Product name: | HHEX monoclonal antibody (M10), clone 4E9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HHEX. |
| Clone: | 4E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3087 |
| Gene name: | HHEX |
| Gene alias: | HEX|HMPH|HOX11L-PEN|PRH|PRHX |
| Gene description: | hematopoietically expressed homeobox |
| Genbank accession: | NM_002729 |
| Immunogen: | HHEX (NP_002720, 133 a.a. ~ 237 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS |
| Protein accession: | NP_002720 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HHEX monoclonal antibody (M10), clone 4E9 Western Blot analysis of HHEX expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |