Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HGF polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HGF polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003082-A01 |
| Product name: | HGF polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HGF. |
| Gene id: | 3082 |
| Gene name: | HGF |
| Gene alias: | F-TCF|HGFB|HPTA|SF |
| Gene description: | hepatocyte growth factor (hepapoietin A; scatter factor) |
| Genbank accession: | NM_000601 |
| Immunogen: | HGF (NP_000592, 619 a.a. ~ 728 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
| Protein accession: | NP_000592 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Analysis of growth factor expression in affected and unaffected muscles of oculo-pharyngeal muscular dystrophy (OPMD) patients: A pilot study.Bouazza B, Kratassiouk G, Gjata B, Perie S, Guily JL, Butler-Browne GS, Svinartchouk F. Neuromuscul Disord. 2009 Mar;19(3):199-206. Epub 2009 Jan 29. |