No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003082-A01 |
Product name: | HGF polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HGF. |
Gene id: | 3082 |
Gene name: | HGF |
Gene alias: | F-TCF|HGFB|HPTA|SF |
Gene description: | hepatocyte growth factor (hepapoietin A; scatter factor) |
Genbank accession: | NM_000601 |
Immunogen: | HGF (NP_000592, 619 a.a. ~ 728 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
Protein accession: | NP_000592 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Analysis of growth factor expression in affected and unaffected muscles of oculo-pharyngeal muscular dystrophy (OPMD) patients: A pilot study.Bouazza B, Kratassiouk G, Gjata B, Perie S, Guily JL, Butler-Browne GS, Svinartchouk F. Neuromuscul Disord. 2009 Mar;19(3):199-206. Epub 2009 Jan 29. |