No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00003081-M10 |
Product name: | HGD monoclonal antibody (M10), clone 3G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HGD. |
Clone: | 3G4 |
Isotype: | IgG2b Kappa |
Gene id: | 3081 |
Gene name: | HGD |
Gene alias: | AKU|HGO |
Gene description: | homogentisate 1,2-dioxygenase (homogentisate oxidase) |
Genbank accession: | NM_000187 |
Immunogen: | HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN |
Protein accession: | NP_000178 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged HGD is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |