HGD monoclonal antibody (M09), clone 2C10 View larger

HGD monoclonal antibody (M09), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGD monoclonal antibody (M09), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,IP

More info about HGD monoclonal antibody (M09), clone 2C10

Brand: Abnova
Reference: H00003081-M09
Product name: HGD monoclonal antibody (M09), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant HGD.
Clone: 2C10
Isotype: IgG2b Kappa
Gene id: 3081
Gene name: HGD
Gene alias: AKU|HGO
Gene description: homogentisate 1,2-dioxygenase (homogentisate oxidase)
Genbank accession: NM_000187
Immunogen: HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Protein accession: NP_000178
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003081-M09-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HGD is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy HGD monoclonal antibody (M09), clone 2C10 now

Add to cart