| Brand: | Abnova |
| Reference: | H00003081-M09 |
| Product name: | HGD monoclonal antibody (M09), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HGD. |
| Clone: | 2C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3081 |
| Gene name: | HGD |
| Gene alias: | AKU|HGO |
| Gene description: | homogentisate 1,2-dioxygenase (homogentisate oxidase) |
| Genbank accession: | NM_000187 |
| Immunogen: | HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN |
| Protein accession: | NP_000178 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HGD is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |