Cart 72 Product Products 29 230,83 € (empty)
No products
To be determined Shipping
29 230,83 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 72 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 29 230,83 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 29 230,83 €
Data sheet of HGD purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about HGD purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003081-D01P |
| Product name: | HGD purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human HGD protein. |
| Gene id: | 3081 |
| Gene name: | HGD |
| Gene alias: | AKU|HGO |
| Gene description: | homogentisate 1,2-dioxygenase (homogentisate oxidase) |
| Genbank accession: | NM_000187.1 |
| Immunogen: | HGD (AAH71757.1, 1 a.a. ~ 445 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN |
| Protein accession: | AAH71757.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HGD expression in transfected 293T cell line (H00003081-T01) by HGD MaxPab polyclonal antibody. Lane 1: HGD transfected lysate(50.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Adaptation of phenylalanine and tyrosine catabolic pathway to hibernation in bats.Pan YH, Zhang Y, Cui J, Liu Y, McAllan BM, Liao CC, Zhang S PLoS One. 2013 Apr 19;8(4):e62039. doi: 10.1371/journal.pone.0062039. Print 2013. |