HGD MaxPab mouse polyclonal antibody (B01) View larger

HGD MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGD MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about HGD MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003081-B01
Product name: HGD MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HGD protein.
Gene id: 3081
Gene name: HGD
Gene alias: AKU|HGO
Gene description: homogentisate 1,2-dioxygenase (homogentisate oxidase)
Genbank accession: NM_000187.1
Immunogen: HGD (AAH71757.1, 1 a.a. ~ 445 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Protein accession: AAH71757.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003081-B01-13-15-1.jpg
Application image note: Western Blot analysis of HGD expression in transfected 293T cell line (H00003081-T01) by HGD MaxPab polyclonal antibody.

Lane1:HGD transfected lysate(48.95 KDa).
Lane2:Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HGD MaxPab mouse polyclonal antibody (B01) now

Add to cart