Cart 111 Product Products 36 143,75 € (empty)
No products
To be determined Shipping
36 143,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 111 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 36 143,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 36 143,75 €
Data sheet of HFE monoclonal antibody (M01), clone 1G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HFE monoclonal antibody (M01), clone 1G12
| Brand: | Abnova |
| Reference: | H00003077-M01 |
| Product name: | HFE monoclonal antibody (M01), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HFE. |
| Clone: | 1G12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3077 |
| Gene name: | HFE |
| Gene alias: | HFE1|HH|HLA-H|MGC103790|dJ221C16.10.1 |
| Gene description: | hemochromatosis |
| Genbank accession: | NM_000410 |
| Immunogen: | HFE (NP_000401, 115 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ |
| Protein accession: | NP_000401 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to HFE on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer.Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, Liu FF PLoS One. 2013 Aug 26;8(8):e74075. doi: 10.1371/journal.pone.0074075. |