No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003068-M09 |
Product name: | HDGF monoclonal antibody (M09), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HDGF. |
Clone: | 2D6 |
Isotype: | IgG2a Kappa |
Gene id: | 3068 |
Gene name: | HDGF |
Gene alias: | DKFZp686J1764|FLJ96580|HMG1L2 |
Gene description: | hepatoma-derived growth factor (high-mobility group protein 1-like) |
Genbank accession: | NM_004494 |
Immunogen: | HDGF (NP_004485, 184 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL |
Protein accession: | NP_004485 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (32.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged HDGF is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |