No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IP |
Brand: | Abnova |
Reference: | H00003065-D01 |
Product name: | HDAC1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human HDAC1 protein. |
Gene id: | 3065 |
Gene name: | HDAC1 |
Gene alias: | DKFZp686H12203|GON-10|HD1|RPD3|RPD3L1 |
Gene description: | histone deacetylase 1 |
Genbank accession: | NM_004964.2 |
Immunogen: | HDAC1 (NP_004955.2, 1 a.a. ~ 482 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA |
Protein accession: | NP_004955.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of HDAC1 transfected lysate using anti-HDAC1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HDAC1 MaxPab mouse polyclonal antibody (B01) (H00003065-B01). |
Applications: | IP |
Shipping condition: | Dry Ice |