No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00003065-A02 |
Product name: | HDAC1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HDAC1. |
Gene id: | 3065 |
Gene name: | HDAC1 |
Gene alias: | DKFZp686H12203|GON-10|HD1|RPD3|RPD3L1 |
Gene description: | histone deacetylase 1 |
Genbank accession: | NM_004964 |
Immunogen: | HDAC1 (NP_004955, 28 a.a. ~ 137 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAG |
Protein accession: | NP_004955 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |