No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003064-M13 |
Product name: | HD monoclonal antibody (M13), clone 1A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HD. |
Clone: | 1A12 |
Isotype: | IgG2b Kappa |
Gene id: | 3064 |
Gene name: | HTT |
Gene alias: | HD|IT15 |
Gene description: | huntingtin |
Genbank accession: | NM_002111 |
Immunogen: | HD (NP_002102, 1524 a.a. ~ 1627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDS |
Protein accession: | NP_002102 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |