| Brand: | Abnova |
| Reference: | H00003059-M06 |
| Product name: | HCLS1 monoclonal antibody (M06), clone 2A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HCLS1. |
| Clone: | 2A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3059 |
| Gene name: | HCLS1 |
| Gene alias: | CTTNL|HS1 |
| Gene description: | hematopoietic cell-specific Lyn substrate 1 |
| Genbank accession: | BC016758 |
| Immunogen: | HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
| Protein accession: | AAH16758 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HCLS1 monoclonal antibody (M06), clone 2A9 Western Blot analysis of HCLS1 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |