Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003050-M03 |
Product name: | HBZ monoclonal antibody (M03), clone 1G10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HBZ. |
Clone: | 1G10 |
Isotype: | IgG2b Kappa |
Gene id: | 3050 |
Gene name: | HBZ |
Gene alias: | - |
Gene description: | hemoglobin, zeta |
Genbank accession: | NM_005332 |
Immunogen: | HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL |
Protein accession: | NP_005323 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10. Lane 1: HBZ transfected lysate(15.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |