Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBG1 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HBG1 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00003047-A02 |
| Product name: | HBG1 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HBG1. |
| Gene id: | 3047 |
| Gene name: | HBG1 |
| Gene alias: | HBGA|HBGR|HSGGL1|PRO2979 |
| Gene description: | hemoglobin, gamma A |
| Genbank accession: | NM_000559 |
| Immunogen: | HBG1 (NP_000550, 44 a.a. ~ 106 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKL |
| Protein accession: | NP_000550 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Synthetic Model of Human Beta-Thalassemia Erythropoiesis Using CD34+ Cells from Healthy Adult Donors.Lee YT, Kim KS, Byrnes C, de Vasconcellos JF, Noh SJ, Rabel A, Meier ER, Miller JL PLoS One. 2013 Jul 8;8(7):e68307. doi: 10.1371/journal.pone.0068307. Print 2013. |