Cart 41 Product Products 14 096,79 € (empty)
No products
To be determined Shipping
14 096,79 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 41 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 096,79 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 096,79 €
Data sheet of HBG1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about HBG1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003047-A01 |
| Product name: | HBG1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant HBG1. |
| Gene id: | 3047 |
| Gene name: | HBG1 |
| Gene alias: | HBGA|HBGR|HSGGL1|PRO2979 |
| Gene description: | hemoglobin, gamma A |
| Genbank accession: | BC010913 |
| Immunogen: | HBG1 (AAH10913, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH |
| Protein accession: | AAH10913 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |