| Brand: | Abnova |
| Reference: | H00003043-M02 |
| Product name: | HBB monoclonal antibody (M02), clone 7B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HBB. |
| Clone: | 7B12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3043 |
| Gene name: | HBB |
| Gene alias: | CD113t-C |
| Gene description: | hemoglobin, beta |
| Genbank accession: | BC007075 |
| Immunogen: | HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH |
| Protein accession: | AAH07075 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Hemoglobin alpha and beta are ubiquitous in the human lung, decline in idiopathic pulmonary fibrosis but not in COPD.Ishikawa N, Ohlmeier S, Salmenkivi K, Myllarniemi M, Rahman I, Mazur W, Kinnula VL. Respir Res. 2010 Sep 13;11:123. |