| Brand: | Abnova |
| Reference: | H00003043-M01 |
| Product name: | HBB monoclonal antibody (M01), clone 2H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HBB. |
| Clone: | 2H3 |
| Isotype: | IgG3 Kappa |
| Gene id: | 3043 |
| Gene name: | HBB |
| Gene alias: | CD113t-C |
| Gene description: | hemoglobin, beta |
| Genbank accession: | BC007075 |
| Immunogen: | HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH |
| Protein accession: | AAH07075 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HBB is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Restoration of the balanced {alpha}/{beta}-globin gene expression in {beta}654-thalassemia mice using combined RNAi and antisense RNA approach.Xie SY, Ren ZR, Zhang JZ, Guo XB, Wang QX, Wang S, Lin D, Gong XL, Li W, Huang SZ, Zeng F, Zeng YT. Hum Mol Genet. 2007 Nov 1;16(21):2616-25. Epub 2007 Aug 22. |