View larger

HARS monoclonal antibody (M03), clone 4D4

Reference:

Condition: New product

Data sheet of HARS monoclonal antibody (M03), clone 4D4

Brand:	Abnova
Reference:	H00003035-M03
Product name:	HARS monoclonal antibody (M03), clone 4D4
Product description:	Mouse monoclonal antibody raised against a partial recombinant HARS.
Clone:	4D4
Isotype:	IgG2a Kappa
Gene id:	3035
Gene name:	HARS
Gene alias:	FLJ20491\|HRS
Gene description:	histidyl-tRNA synthetase
Genbank accession:	NM_002109
Immunogen:	HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Protein accession:	NP_002100
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.3 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	HARS monoclonal antibody (M03), clone 4D4. Western Blot analysis of HARS expression in HeLa ( Cat # L013V1 ).
Applications:	WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice