Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HARS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HARS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003035-A01 |
| Product name: | HARS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HARS. |
| Gene id: | 3035 |
| Gene name: | HARS |
| Gene alias: | FLJ20491|HRS |
| Gene description: | histidyl-tRNA synthetase |
| Genbank accession: | NM_002109 |
| Immunogen: | HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV |
| Protein accession: | NP_002100 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | New mortalin and histidyl tRNA synthetase isoforms point out a pitfall in proteomic analysis of Egr1 genetically modified mice.Chardonnet S, Decottignies P, Amar L, Le Caer JP, Davis S, Laroche S, Le Marechal P. Proteomics. 2007 Jan;7(2):289-98. |