| Brand: | Abnova |
| Reference: | H00003033-M01 |
| Product name: | HADHSC monoclonal antibody (M01), clone 4B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HADHSC. |
| Clone: | 4B5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3033 |
| Gene name: | HADH |
| Gene alias: | HAD|HADH1|HADHSC|HHF4|M/SCHAD|MGC8392|SCHAD |
| Gene description: | hydroxyacyl-Coenzyme A dehydrogenase |
| Genbank accession: | NM_005327 |
| Immunogen: | HADHSC (NP_005318, 205 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK |
| Protein accession: | NP_005318 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Independent effects of endurance training and weight loss on peak fat oxidation in moderately overweight men: a randomized controlled trial.Nordby P, Rosenkilde M, Ploug T, Westh K, Feigh M, Nielsen NB, Helge JW, Stallknecht B. J Appl Physiol (1985). 2015 Apr 1;118(7):803-10. |