Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HAGH monoclonal antibody (M01), clone 4D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about HAGH monoclonal antibody (M01), clone 4D3
| Brand: | Abnova |
| Reference: | H00003029-M01 |
| Product name: | HAGH monoclonal antibody (M01), clone 4D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HAGH. |
| Clone: | 4D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3029 |
| Gene name: | HAGH |
| Gene alias: | GLO2|GLX2|GLXII|HAGH1 |
| Gene description: | hydroxyacylglutathione hydrolase |
| Genbank accession: | NM_005326 |
| Immunogen: | HAGH (NP_005317, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD |
| Protein accession: | NP_005317 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |