| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003028-B01 |
| Product name: | HSD17B10 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HSD17B10 protein. |
| Gene id: | 3028 |
| Gene name: | HSD17B10 |
| Gene alias: | 17b-HSD10|ABAD|CAMR|DUPXp11.22|ERAB|HADH2|HCD2|MHBD|MRPP2|MRX17|MRX31|MRXS10|SCHAD|SDR5C1 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 10 |
| Genbank accession: | NM_004493.2 |
| Immunogen: | HSD17B10 (NP_004484.1, 1 a.a. ~ 261 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP |
| Protein accession: | NP_004484.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HSD17B10 expression in transfected 293T cell line (H00003028-T01) by HSD17B10 MaxPab polyclonal antibody. Lane 1: HADH2 transfected lysate(28.71 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Enhanced levels of mitochondrial enzyme 17b-hydroxysteroid dehydrogenase type 10 in patients with Alzheimer disease and multiple sclerosis.Kristofikova Z, Bockova M, Hegnerova K, Bartos A, Klaschka J, Ricny J, Ripova D, Homola J. Mol Biosyst. 2009 Oct;5(10):1174-9. Epub 2009 Jul 6. |