| Brand: | Abnova |
| Reference: | H00003026-M01 |
| Product name: | HABP2 monoclonal antibody (M01), clone 1H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HABP2. |
| Clone: | 1H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3026 |
| Gene name: | HABP2 |
| Gene alias: | FSAP|HABP|HGFAL|PHBP |
| Gene description: | hyaluronan binding protein 2 |
| Genbank accession: | NM_004132 |
| Immunogen: | HABP2 (NP_004123, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG |
| Protein accession: | NP_004123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HABP2 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |
| Publications: | Anti-Adipogenic Polyphenols of Water Shield Suppress TNF-α-Induced Cell Damage and Enhance Expression of HAS2 and HAPB2 in Adiponectin-Treated Dermal Fibroblasts.Shimoda H, Nakamura S, Hitoe S, Terazawa S, Tanaka J, Matsumoto T, Matsuda H. Nat Prod Chem Res 2:146. |