| Brand: | Abnova |
| Reference: | H00003021-M01 |
| Product name: | H3F3B monoclonal antibody (M01), clone 2D7-H1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant H3F3B. |
| Clone: | 2D7-H1 |
| Isotype: | IgG1 kappa |
| Gene id: | 3021 |
| Gene name: | H3F3B |
| Gene alias: | H3.3B|H3F3A |
| Gene description: | H3 histone, family 3B (H3.3B) |
| Genbank accession: | BC017558 |
| Immunogen: | H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Protein accession: | AAH17558 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes.Jullien J, Astrand C, Szenker E, Garrett N, Almouzni G, Gurdon J. Epigenetics Chromatin. 2012 Oct 29;5(1):17. [Epub ahead of print] |