View larger

H2AFX monoclonal antibody (M17), clone 2H5

Reference:

Condition: New product

Data sheet of H2AFX monoclonal antibody (M17), clone 2H5

Brand:	Abnova
Reference:	H00003014-M17
Product name:	H2AFX monoclonal antibody (M17), clone 2H5
Product description:	Mouse monoclonal antibody raised against a partial recombinant H2AFX.
Clone:	2H5
Isotype:	IgG2a Kappa
Gene id:	3014
Gene name:	H2AFX
Gene alias:	H2A.X\|H2A/X\|H2AX
Gene description:	H2A histone family, member X
Genbank accession:	BC011694
Immunogen:	H2AFX (AAH11694.1, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Protein accession:	AAH11694.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:	http://www.abnova.com/application_image/
Application image note:	Detection limit for recombinant GST tagged H2AFX is approximately 10ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice