Cart 37 Product Products 11 958,83 € (empty)
-
1 x Caspase-8...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
11 958,83 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 37 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 958,83 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 958,83 €
Data sheet of GZMM monoclonal antibody (M03), clone 4D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about GZMM monoclonal antibody (M03), clone 4D11
| Brand: | Abnova |
| Reference: | H00003004-M03 |
| Product name: | GZMM monoclonal antibody (M03), clone 4D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GZMM. |
| Clone: | 4D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3004 |
| Gene name: | GZMM |
| Gene alias: | LMET1|MET1 |
| Gene description: | granzyme M (lymphocyte met-ase 1) |
| Genbank accession: | NM_005317 |
| Immunogen: | GZMM (NP_005308, 85 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCL |
| Protein accession: | NP_005308 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged GZMM is approximately 30ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Granzyme M as a novel effector molecule for human cytolytic fusion proteins: CD64-specific cytotoxicity of Gm-H22(scFv) against leukemic cells.Schiffer S, Letzian S, Jost E, Mladenov R, Hristodorov D, Huhn M, Fischer R, Barth S, Thepen T Cancer Lett. 2013 Aug 22. pii: S0304-3835(13)00578-8. doi: 10.1016/j.canlet.2013.08.005. |