No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00003000-M06 |
| Product name: | GUCY2D monoclonal antibody (M06), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCY2D. |
| Clone: | 1E6 |
| Isotype: | IgG |
| Gene id: | 3000 |
| Gene name: | GUCY2D |
| Gene alias: | CORD5|CORD6|CYGD|GUC1A4|GUC2D|LCA|LCA1|RETGC-1|ROS-GC1|retGC |
| Gene description: | guanylate cyclase 2D, membrane (retina-specific) |
| Genbank accession: | NM_000180 |
| Immunogen: | GUCY2D (NP_000171, 521 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL |
| Protein accession: | NP_000171 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged GUCY2D is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |