No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002992-M08 |
| Product name: | GYG1 monoclonal antibody (M08), clone 2C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GYG1. |
| Clone: | 2C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2992 |
| Gene name: | GYG1 |
| Gene alias: | GYG |
| Gene description: | glycogenin 1 |
| Genbank accession: | NM_004130 |
| Immunogen: | GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT |
| Protein accession: | NP_004121 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | GYG1 monoclonal antibody (M08), clone 2C10. Western Blot analysis of GYG1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |