| Brand: | Abnova |
| Reference: | H00002992-M07 |
| Product name: | GYG1 monoclonal antibody (M07), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GYG1. |
| Clone: | 3B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2992 |
| Gene name: | GYG1 |
| Gene alias: | GYG |
| Gene description: | glycogenin 1 |
| Genbank accession: | NM_004130 |
| Immunogen: | GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT |
| Protein accession: | NP_004121 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | GYG1 monoclonal antibody (M07), clone 3B5 Western Blot analysis of GYG1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Clinical heterogeneity and phenotype/genotype findings in 5 families with GYG1 deficiency.Ben Yaou R, Hubert A, Nelson I, Dahlqvist JR, Gaist D, Streichenberger N, Beuvin M, Krahn M, Petiot P, Parisot F, Michel F, Malfatti E, Romero N, Carlier RY, Eymard B, Labrune P, Duno M, Krag T, Cerino M, Bartoli M, Bonne G, Vissing J, Laforet P, Petit FM. Neurol Genet. 2017 Dec 18;3(6):e208. |