| Brand: | Abnova |
| Reference: | H00002984-M07 |
| Product name: | GUCY2C monoclonal antibody (M07), clone 3H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCY2C. |
| Clone: | 3H6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2984 |
| Gene name: | GUCY2C |
| Gene alias: | GUC2C|STAR |
| Gene description: | guanylate cyclase 2C (heat stable enterotoxin receptor) |
| Genbank accession: | NM_004963.3 |
| Immunogen: | GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL |
| Protein accession: | NP_004954 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |