No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002984-M07 |
Product name: | GUCY2C monoclonal antibody (M07), clone 3H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCY2C. |
Clone: | 3H6 |
Isotype: | IgG2b Kappa |
Gene id: | 2984 |
Gene name: | GUCY2C |
Gene alias: | GUC2C|STAR |
Gene description: | guanylate cyclase 2C (heat stable enterotoxin receptor) |
Genbank accession: | NM_004963.3 |
Immunogen: | GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL |
Protein accession: | NP_004954 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |