No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002980-M01 |
Product name: | GUCA2A monoclonal antibody (M01), clone 7A8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GUCA2A. |
Clone: | 7A8 |
Isotype: | IgG2a Kappa |
Gene id: | 2980 |
Gene name: | GUCA2A |
Gene alias: | GUANYLIN|GUCA2|STARA |
Gene description: | guanylate cyclase activator 2A (guanylin) |
Genbank accession: | NM_033553.2 |
Immunogen: | GUCA2A (NP_291031.2, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC |
Protein accession: | NP_291031.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GUCA2A is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |