Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of GUCA2A monoclonal antibody (M01), clone 7A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about GUCA2A monoclonal antibody (M01), clone 7A8
| Brand: | Abnova |
| Reference: | H00002980-M01 |
| Product name: | GUCA2A monoclonal antibody (M01), clone 7A8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant GUCA2A. |
| Clone: | 7A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2980 |
| Gene name: | GUCA2A |
| Gene alias: | GUANYLIN|GUCA2|STARA |
| Gene description: | guanylate cyclase activator 2A (guanylin) |
| Genbank accession: | NM_033553.2 |
| Immunogen: | GUCA2A (NP_291031.2, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC |
| Protein accession: | NP_291031.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GUCA2A is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |