No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002979-M01 |
Product name: | GUCA1B monoclonal antibody (M01), clone 5E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GUCA1B. |
Clone: | 5E7 |
Isotype: | IgG2b Kappa |
Gene id: | 2979 |
Gene name: | GUCA1B |
Gene alias: | DKFZp686E1183|GCAP2|GUCA2 |
Gene description: | guanylate cyclase activator 1B (retina) |
Genbank accession: | NM_002098 |
Immunogen: | GUCA1B (NP_002089, 93 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF |
Protein accession: | NP_002089 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GUCA1B is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |