GTF3A monoclonal antibody (M07), clone 3F7 View larger

GTF3A monoclonal antibody (M07), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF3A monoclonal antibody (M07), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GTF3A monoclonal antibody (M07), clone 3F7

Brand: Abnova
Reference: H00002971-M07
Product name: GTF3A monoclonal antibody (M07), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant GTF3A.
Clone: 3F7
Isotype: IgG2b Kappa
Gene id: 2971
Gene name: GTF3A
Gene alias: AP2|TFIIIA
Gene description: general transcription factor IIIA
Genbank accession: NM_002097
Immunogen: GTF3A (NP_002088, 185 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE
Protein accession: NP_002088
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002971-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GTF3A is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GTF3A monoclonal antibody (M07), clone 3F7 now

Add to cart