| Brand: | Abnova |
| Reference: | H00002971-M06 |
| Product name: | GTF3A monoclonal antibody (M06), clone 4G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GTF3A. |
| Clone: | 4G4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2971 |
| Gene name: | GTF3A |
| Gene alias: | AP2|TFIIIA |
| Gene description: | general transcription factor IIIA |
| Genbank accession: | NM_002097 |
| Immunogen: | GTF3A (NP_002088, 185 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
| Protein accession: | NP_002088 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GTF3A is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |