| Brand: | Abnova |
| Reference: | H00002969-M01 |
| Product name: | GTF2I monoclonal antibody (M01), clone 3E2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GTF2I. |
| Clone: | 3E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2969 |
| Gene name: | GTF2I |
| Gene alias: | BAP-135|BAP135|BTKAP1|DIWS|FLJ38776|FLJ56355|IB291|SPIN|TFII-I|WBS|WBSCR6 |
| Gene description: | general transcription factor II, i |
| Genbank accession: | BC004472 |
| Immunogen: | GTF2I (AAH04472.1, 36 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG |
| Protein accession: | AAH04472.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.03 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | An SNP in an ultraconserved regulatory element affects Dlx5/Dlx6 regulation in the forebrain.Poitras L, Yu M, Lesage-Pelletier C, Macdonald RB, Gagne JP, Hatch G, Kelly I, Hamilton SP, Rubenstein JL, Poirier GG, Ekker M. Development. 2010 Sep;137(18):3089-97. Epub 2010 Aug 11. |