Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 411,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 411,00 €
Data sheet of GTF2H1 monoclonal antibody (M02), clone 4B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about GTF2H1 monoclonal antibody (M02), clone 4B9
| Brand: | Abnova |
| Reference: | H00002965-M02 |
| Product name: | GTF2H1 monoclonal antibody (M02), clone 4B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GTF2H1. |
| Clone: | 4B9 |
| Isotype: | IgG2a kappa |
| Gene id: | 2965 |
| Gene name: | GTF2H1 |
| Gene alias: | BTF2|TFB1|TFIIH |
| Gene description: | general transcription factor IIH, polypeptide 1, 62kDa |
| Genbank accession: | NM_005316 |
| Immunogen: | GTF2H1 (NP_005307, 449 a.a. ~ 548 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | INQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT |
| Protein accession: | NP_005307 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GTF2H1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |