Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GTF2E1 monoclonal antibody (M07A), clone 1E12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about GTF2E1 monoclonal antibody (M07A), clone 1E12
| Brand: | Abnova |
| Reference: | H00002960-M07A |
| Product name: | GTF2E1 monoclonal antibody (M07A), clone 1E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GTF2E1. |
| Clone: | 1E12 |
| Isotype: | IgM Kappa |
| Gene id: | 2960 |
| Gene name: | GTF2E1 |
| Gene alias: | FE|TF2E1|TFIIE-A |
| Gene description: | general transcription factor IIE, polypeptide 1, alpha 56kDa |
| Genbank accession: | NM_005513 |
| Immunogen: | GTF2E1 (NP_005504, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE |
| Protein accession: | NP_005504 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GTF2E1 monoclonal antibody (M07A), clone 1E12. Western Blot analysis of GTF2E1 expression in MCF-7. |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |